PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1360s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 610aa    MW: 68288.8 Da    PI: 8.2321
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1360s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.6e-104644962254
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          ++yp+ ++++ LA++++L+ +qV++WF N R++
  Cagra.1360s0005.1.p 464 HPYPTDSDKQMLATQTSLSRNQVSNWFINARMR 496
                          89******************************9 PP

2BELL96.81.8e-31331399472
                 BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +++ k+akLl l+eeV+k Yk y++qlqtv+ssF+ vagl++a+pY+slAlk+iSr+F++L++ai+eq+
  Cagra.1360s0005.1.p 331 KNRLKRAKLLVLQEEVCKMYKLYNHQLQTVVSSFDSVAGLNTAAPYISLALKQISRSFKALRTAISEQL 399
                          5789***************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-47262397IPR006563POX domain
PfamPF075265.5E-30267396IPR006563POX domain
PROSITE profilePS5007111.904437500IPR001356Homeobox domain
SMARTSM003891.1E-10440504IPR001356Homeobox domain
CDDcd000868.92E-12440501No hitNo description
SuperFamilySSF466897.27E-17442506IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-27443504IPR009057Homeodomain-like
PfamPF059207.0E-18457496IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDMIKPDLHV AQQIRRDKFR VEQMNDFSNT WGHDHENIRI PNNLDLIGIL QNQIPVPVQT  60
DLYQDSTTTF MNMPQSIHRD PQGSSNWRSC DLSQPSSAVG DFFSNQFSSR NQILDRPLNV  120
GRDTIAQSSM TSRSEVPCLK DNQKGCVTFL GQNNLENIVT VACSGTGNET SKSTYDRGTL  180
SGSYRGELMF LPGLENHSVA QNASQWNYRS SCKVPMNFSA TSHTNKKGFS LSLSSEVTPF  240
RDSGDVAVLS MMNMNGPLGP FTGYASILKS SRFLEPAQNM LEDFCISNAL RTISGSESTS  300
MDNDDSSEML SSTNHAVDGF SSSSSEALKP KNRLKRAKLL VLQEEVCKMY KLYNHQLQTV  360
VSSFDSVAGL NTAAPYISLA LKQISRSFKA LRTAISEQLK QISSTQDSSS GDNNIIHKQQ  420
RSLIGNNVEF ESQQQGQHIW RPQRGLPERA VAVLRAWLFD HFLHPYPTDS DKQMLATQTS  480
LSRNQVSNWF INARMRLWKP MVEEIHMLET KVIKSKDSIN NMEQSSIRPN ILSSLPNRKQ  540
TLKDLSGSKR PRVDYVCDSG MNMMGFNRRL GNVSLTLGLM HGVDNVIQTR TTQDHDHQIG  600
TGGQMFHDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-154434971065Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1191531e-151AK119153.1 Arabidopsis thaliana At2g27990 mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL21-50-D24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295740.10.0hypothetical protein CARUB_v10024860mg
SwissprotQ9SJJ30.0BLH8_ARATH; BEL1-like homeodomain protein 8
TrEMBLR0HX260.0R0HX26_9BRAS; Uncharacterized protein
STRINGAT2G27990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143211520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.10.0BEL1-like homeodomain 8